PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G078300.1
Common NamePHAVU_010G078300g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 232aa    MW: 26349 Da    PI: 8.8274
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G078300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.81.2e-18177223148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT+eEd  lv++v+q+G++ W+ Ia+ m  +R +kqc++rw+++l
  Phvul.010G078300.1 177 KGQWTPEEDSALVELVNQFGPKKWSEIAKLMC-RRVGKQCRERWHNHL 223
                         799*****************************.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.72E-18171227IPR009057Homeodomain-like
PROSITE profilePS5129428.199172227IPR017930Myb domain
SMARTSM007175.1E-16176225IPR001005SANT/Myb domain
PfamPF002495.6E-17177223IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-23177226IPR009057Homeodomain-like
CDDcd001671.64E-16180223No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEFDPCFLSG IFPKNPYLKP HTHQNMFPSQ SSFLIPPSQP IMFHPNHAFY HFQNHIVNVP  60
AHNPITAPMY GNGIPTPSLG HDGSSLTGFV NINSHQPVML APKNNNKIEA LYDHHKGKVI  120
WDFSQKSMVH PFEASSSKSP SPFSLSNEYG LGMSGFHRDT DPRMVEVEKN MNSNIIKGQW  180
TPEEDSALVE LVNQFGPKKW SEIAKLMCRR VGKQCRERWH NHLRPNIRIE V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mbg_A2e-18175225151MYB PROTO-ONCOGENE PROTEIN
1mbh_A2e-18175225151C-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150424e-91AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134812.11e-173hypothetical protein PHAVU_010G078300g
TrEMBLV7ARG11e-173V7ARG1_PHAVU; Uncharacterized protein
STRINGGLYMA03G15930.28e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF143361018
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.12e-23myb domain protein 118